PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10025867m
Common NameEUTSA_v10025867mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 296aa    MW: 33202.5 Da    PI: 9.6898
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10025867mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind319.31.2e-9712951301
        GAGA_bind   1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalv 75 
                      m++ g++e  r k+ yy+                ++++l   +++++ms++aerda+++ern a+++kk+a+a+rd+a+ qrdkal+er++a++
  Thhalv10025867m   1 MESGGQYEngRYKPdYYKgtesvwnmmpqhqikeQHNALV--MNKKIMSILAERDAAVKERNEAVAAKKEALAARDEALEQRDKALSERDNAIM 92 
                      888999888999999999*********9887765446666..99************************************************** PP

        GAGA_bind  76 erdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkk 169
                      er+++l al+++en+l+  l+  +    g+                ++  ++e++  +  pi++ ++ea +++  k   r+k+ k+++++k kk
  Thhalv10025867m  93 ERESALNALQYRENNLNYILS--CARRGGS----------------QSCVTEESHLPDPSPISTIPPEAANTRPAK---RKKQSKQETRSKGKK 165
                      **************9654441..1111111................122235667778999*******99999988...666777777788888 PP

        GAGA_bind 170 ksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqg 263
                       +e+ +++v++++  ++ +++++s d++ln v++De+t+PvP+C+CtG+ rqCYkWGnGGWqS+CCttt+S+yPLP+++++r++R++grKmS++
  Thhalv10025867m 166 VGEDLNRQVASPG--KKCRKDWDSNDVGLNLVTFDETTMPVPMCTCTGTARQCYKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGS 257
                      8999*********..56***************************************************************************** PP

        GAGA_bind 264 afkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                      +f++lL++La++G++ls pvDLkd+WA+HGtn+++ti+
  Thhalv10025867m 258 VFSRLLSRLAGQGHELSSPVDLKDYWARHGTNRYITIK 295
                      *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.5E-1641295IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-9318295IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MESGGQYENG RYKPDYYKGT ESVWNMMPQH QIKEQHNALV MNKKIMSILA ERDAAVKERN  60
EAVAAKKEAL AARDEALEQR DKALSERDNA IMERESALNA LQYRENNLNY ILSCARRGGS  120
QSCVTEESHL PDPSPISTIP PEAANTRPAK RKKQSKQETR SKGKKVGEDL NRQVASPGKK  180
CRKDWDSNDV GLNLVTFDET TMPVPMCTCT GTARQCYKWG NGGWQSSCCT TTLSQYPLPQ  240
MPNKRHSRMG GRKMSGSVFS RLLSRLAGQG HELSSPVDLK DYWARHGTNR YITIK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00480DAPTransfer from AT4G38910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6336030.0EF633603.1 Cardamine pratensis GAGA-motif binding transcriptional activator (BBR/BPC5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411681.10.0hypothetical protein EUTSA_v10025867mg
SwissprotF4JUI30.0BPC5_ARATH; Protein BASIC PENTACYSTEINE5
TrEMBLV4M9X70.0V4M9X7_EUTSA; Uncharacterized protein
STRINGAT4G38910.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38910.21e-180basic pentacysteine 5